Package: xportr 0.5.0.9000


Eli Miller
xportr: Utilities to Output CDISC SDTM/ADaM XPT Files
Tools to build CDISC compliant data sets and check for CDISC compliance.
Authors:
xportr_0.5.0.9000.tar.gz
xportr_0.5.0.9000.zip(r-4.7)xportr_0.5.0.9000.zip(r-4.6)xportr_0.5.0.9000.zip(r-4.5)
xportr_0.5.0.9000.tgz(r-4.6-any)xportr_0.5.0.9000.tgz(r-4.5-any)
xportr_0.5.0.9000.tar.gz(r-4.7-any)xportr_0.5.0.9000.tar.gz(r-4.6-any)
xportr_0.5.0.9000.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
xportr/json (API)
| # Install 'xportr' in R: |
| install.packages('xportr', repos = c('https://atorus-research.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/atorus-research/xportr/issues
Pkgdown/docs site:https://atorus-research.github.io
- adsl_xportr - Analysis Dataset Subject Level
- dataset_spec - Example Dataset Specification
- var_spec - Example Dataset Variable Specification
Last updated from:712302f8b9. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 170 | ||
| source / vignettes | OK | 202 | ||
| linux-release-x86_64 | OK | 196 | ||
| macos-release-arm64 | OK | 121 | ||
| macos-oldrel-arm64 | OK | 102 | ||
| windows-devel | OK | 152 | ||
| windows-release | OK | 133 | ||
| windows-oldrel | OK | 139 | ||
| wasm-release | OK | 159 |
Exports:xportrxportr_df_labelxportr_formatxportr_labelxportr_lengthxportr_metadataxportr_optionsxportr_orderxportr_splitxportr_typexportr_writexpt_validate
Dependencies:backportsbitbit64checkmateclicliprcpp11crayondplyrforcatsgenericsgluehavenhmslifecyclemagrittrpillarpkgconfigprettyunitsprogresspurrrR6readrrlangstringistringrtibbletidyselecttzdbutf8vctrsvroomwithr
Last update: 2026-05-21
Started: 2023-06-21
Last update: 2026-05-21
Started: 2021-05-17
Last update: 2024-03-07
Started: 2024-03-07
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Analysis Dataset Subject Level | adsl_xportr |
| Example Dataset Specification | dataset_spec |
| Example Dataset Variable Specification | var_spec |
| Wrapper to apply all core xportr functions and write xpt | xportr |
| Assign Dataset Label | xportr_df_label |
| Assign SAS Format | xportr_format |
| Assign Variable Label | xportr_label |
| Assign SAS Length | xportr_length |
| Set variable specifications and domain | xportr_metadata |
| Get or set xportr options | xportr_options |
| Order variables of a dataset according to Spec | xportr_order |
| Deprecated - Split xpt file output | xportr_split |
| Coerce variable type | xportr_type |
| Write xpt v5 transport file | xportr_write |
| Validate Dataset Can be Written to xpt | xpt_validate |